SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2EFH8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A2EFH8
Domain Number - Region: 100-129
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0156
Family Tudor domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A2EFH8
Sequence length 158
Comment (tr|A2EFH8|A2EFH8_TRIVA) Uncharacterized protein {ECO:0000313|EMBL:EAY08572.1} KW=Complete proteome; Reference proteome OX=5722 OS=Trichomonas vaginalis. GN=TVAG_190950 OC=Eukaryota; Parabasalia; Trichomonadida; Trichomonadidae; Trichomonas.
Sequence
MTSKEEDEYIKQKRMLTEERRSSSLLPGTKVRIILEHKPHEKVRNQLSDDYYIVDSSQGN
GYLIKAADHSVAFYLRFRLVESENGRLAKTVDEAKRGIVNKIVSYDEDKDEYTVIYEGGV
DDKIPSRNLRESNPTHLSELEKDYWKDKNKPKLIKKFL
Download sequence
Identical sequences A2EFH8
XP_001320795.1.43485 5722.A2EFH8 gi|121903608|gb|EAY08572.1| gi|123475233|ref|XP_001320795.1| 86633.m00133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]