SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2FGV0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2FGV0
Domain Number 1 Region: 284-567
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.67e-93
Family Ankyrin repeat 0.0000278
Further Details:      
 
Domain Number 2 Region: 47-52,135-250
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000000085
Family Pseudo ankyrin repeat 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A2FGV0
Sequence length 570
Comment (tr|A2FGV0|A2FGV0_TRIVA) Ankyrin repeat protein, putative {ECO:0000313|EMBL:EAX95854.1} KW=Complete proteome; Reference proteome OX=5722 OS=Trichomonas vaginalis. GN=TVAG_053690 OC=Eukaryota; Parabasalia; Trichomonadida; Trichomonadidae; Trichomonas.
Sequence
MSDQDVHPNKYSELLSICKYDIDTYITLYQLKTENEEELNKIYKMIKKELIDSKKYRPQD
IIKDILDIIYYNNRYTKSYLYLAKLISDDYHVNEIEDFKSILNFLFYKEYGIKLDKFDDF
EKCKFENLDIHTDDTIYRAIMYNDLERFIYFIENEGFHQNQILICKLYPYTGKGYSLLEL
CCYHGAVDCFKLLRTKFKSEITQECLQFSFLGRNQEIMSECLKYQVPDNRCMKYAIISHN
IDFVTFLMNEYNMPIDLDYCEWHRNIESFLVYFDQTNDLNECFIYSVSFNITSLCEHFLS
LGANINEINKHGETALHYAAEKNNKEIAELLISCGANINEKNKYGETVLHYAAEKNNKEM
AELLISCGANINEKNKYGETVLHYAAEKNNKEMAELLISCGANINEKNKYGETVLHYAAE
KNNKEIAGLFISCGANINKKDNYTKTALHTAAEHNNKETAKLLISSGANINEKGNIGETA
LHYATRCNNKETVELLISCGANINEKNQYEETALHYATRYCNKEMAELLISLGANINEKN
KYEETALHYATMSNNISTVELLISHGATTY
Download sequence
Identical sequences A2FGV0
XP_001308784.1.43485 5722.A2FGV0 82091.m00080 gi|121890481|gb|EAX95854.1| gi|123434305|ref|XP_001308784.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]