SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2FUD3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2FUD3
Domain Number 1 Region: 237-604
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.17e-93
Family Ankyrin repeat 0.0000516
Further Details:      
 
Domain Number 2 Region: 529-867
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.68e-86
Family Ankyrin repeat 0.0000244
Further Details:      
 
Domain Number 3 Region: 71-91,126-210
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000301
Family Pseudo ankyrin repeat 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A2FUD3
Sequence length 887
Comment (tr|A2FUD3|A2FUD3_TRIVA) Ankyrin repeat protein, putative {ECO:0000313|EMBL:EAX91485.1} KW=Complete proteome; Reference proteome OX=5722 OS=Trichomonas vaginalis. GN=TVAG_384650 OC=Eukaryota; Parabasalia; Trichomonadida; Trichomonadidae; Trichomonas.
Sequence
MMFYNIGYLKSYLLLSKMICEEYNVKQVQGVSSIFNFLFNEEYGLVLDNDGIWEFVYLQD
SLNHHILEKYTINRAILYDDIKSFIAITQSQGFDKAQSLTPNVIKYHRRDWHYNSLYPIS
LNVYSLLELCCYHGAVDCFKFLRTEFKSEITQVCLELSFLGGNPEIMNECLKKIQPNDRC
MKNAIISHNIDFVTFLMNEYSIEINLEDCVKYKNLQAFFIYLEKTKDIGSCFANSPLFND
LDLCKYLLKHRAKISSKDKYGETVLHSAARSRNIEIMNFIVLKGFDVNATNNLGESALHI
ASKINCKEIAEFLISNGSKINAKDNDNKMPLHHAATCYNANKDLVEFLILHGADINSRDN
QYRLPLHYASIHHSLKIVELLITRGVDIIAQDCYNKSAMHYAIENDNEEIVELLLPYVAD
ITLANNGKKSILQFAIESNNVKIVEFFATHGVDIKIKDNKNKTVLHHAVINDLKEMVNYL
ISLGVEVNAKDNDNKSALYYTIANSNTEIVDLLISNGADVNAKDSQNKTILHYATRIHNK
EIIELLISNGAEIKFMDDENKSFLHYAVENDNWVIIEPLISHGIDVNAKDNDNKTAIHYA
IENDQDLIVRLLVSNGADLNSKDNENKTILHYAIEKMREEIVEFLISNGADVNVKDNENK
TILHYAVEYDVGELVDYFVQLGIDINSKDKNGQTALYFAVVKELPEMVELLVLLGADIDA
KENKFGSTALHYAVINELDIMINNLILSGADVNAKDDILGNTPLHYAVLIDNPYLVKQLI
DQVQVDINAKNKNGQTPLHLAVSKNKKSMVNILASNGADINSKDNENKTPLHYAAQLYNK
KMIYELLKFDADVEAKDINGNTPLLYLERLNHDTKQSKGSFFSNSFF
Download sequence
Identical sequences A2FUD3
XP_001304415.1.43485 93605.m00045 gi|121885865|gb|EAX91485.1| gi|123414066|ref|XP_001304415.1| 5722.A2FUD3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]