SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2GXZ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A2GXZ1
Domain Number - Region: 100-129
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0156
Family Tudor domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A2GXZ1
Sequence length 158
Comment (tr|A2GXZ1|A2GXZ1_TRIVA) Uncharacterized protein {ECO:0000313|EMBL:EAX77976.1} KW=Complete proteome; Reference proteome OX=5722 OS=Trichomonas vaginalis. GN=TVAG_484790 OC=Eukaryota; Parabasalia; Trichomonadida; Trichomonadidae; Trichomonas.
Sequence
MTSKEEDEYIKQKRMLTEERRSSSLLPGTKVRIILEHKPHEKVRNQLSDDYYIVDSSQGN
GYLIKAADHSVAFYPRFRLVESENGRLAKTVDEAKRGIVNKIVSYDEDKDEYTVIYEGGV
DDKIPSRNLRESNPTHLSELEKDYWKNKNKPKLIKKFL
Download sequence
Identical sequences A2GXZ1
gi|121864185|gb|EAX77976.1| gi|123298567|ref|XP_001290906.1| 5722.A2GXZ1 97036.m00003 XP_001290906.1.43485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]