SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2RT81 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2RT81
Domain Number 1 Region: 153-349
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.1e-39
Family SPRY domain 0.00033
Further Details:      
 
Domain Number 2 Region: 12-81
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000222
Family RING finger domain, C3HC4 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A2RT81
Sequence length 352
Comment (tr|A2RT81|A2RT81_MOUSE) Ring finger protein 39 {ECO:0000313|EMBL:AAI32406.1, ECO:0000313|Ensembl:ENSMUSP00000037860} KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=mCG_22610 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MEAPELGPGLVERLEQLATCPLCGGPFEDPVLLACEHSFCRACLARCWGAPAASGSEAAP
PSCPCCGQPCPRRSLRSNVRLAVEVRISRGLREKLAEPGARAGRRRGGRIPTMGCLDPHG
EDMRKTWRRFDVPAPKPSNSEEDLPEDYPVVKNMLHRLTADLTLDPRTAHRDLLISSDYR
GVSLAPPGTPAPLDSPARFDQLPAVLGAQGFASGRHCWEVETAEGASFRDSTAQDENAGE
SCYAVGAAGESVTRKGLIKLCPSEAIWAVEGRGGRLWALTAPEPTLLGGARPPPQRIRVD
LDWERGRVAFYDGRSLDLLFAFQAPGPLGERVFPLLCTCDPRTPLRILPGEA
Download sequence
Identical sequences A2RT81
NP_001093102.1.92730 ENSMUSP00000037860 ENSMUSP00000037860 10090.ENSMUSP00000037860 ENSMUSP00000037860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]