SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2T7L8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2T7L8
Domain Number 1 Region: 133-202
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.44e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A2T7L8
Sequence length 347
Comment (sp|A2T7L8|TFEC_PONPY) Transcription factor EC OX=9600 OS=Pongo pygmaeus (Bornean orangutan). GN=TFEC; OC=Catarrhini; Hominidae; Pongo.
Sequence
MTLDHQIINPTLKWSQPAVPSGGPLVQHAHTTLDSDAGLTENPLTKLLAIGKEDDNAQWH
MEDVIEDIIGMESSFKEEGADSPLLMQRTLSGSILDVYSGEQGISPINMGLTSASCPSSL
PMKREITETDTRALAKERQKKDNHNLIERRRRYNINYRIKELGTLIPKSNDPDMRWNKGT
ILKASVEYIKWLQKEQQRARELEHRQKKLEQANRRLLLRIQELEIQARTHGLPTLASLGT
VDLGAHVTKQQSHPEQNSVDYCQQLTVSQGPSPELCDQAIAFSDPLSYFTDLSFSAALKE
EQRLDGMLLDDTISPFGTDPLLSATSPAVSKESSRRSSFSSDDGDEL
Download sequence
Identical sequences A2T7L8 O14948
ENSP00000265440 9606.ENSP00000265440 NP_036384.1.87134 NP_036384.1.92137 XP_016867364.1.92137 ENSP00000265440 gi|6912702|ref|NP_036384.1| O14948 ENSP00000265440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]