SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2U1E7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2U1E7
Domain Number 1 Region: 48-257
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 1.07e-32
Family Endonuclease I 0.0015
Further Details:      
 
Domain Number 2 Region: 282-456
Classification Level Classification E-value
Superfamily Fibronectin type III 3.6e-23
Family Fibronectin type III 0.00016
Further Details:      
 
Weak hits

Sequence:  A2U1E7
Domain Number - Region: 472-544
Classification Level Classification E-value
Superfamily Lamin A/C globular tail domain 0.000183
Family Lamin A/C globular tail domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A2U1E7
Sequence length 732
Comment (tr|A2U1E7|A2U1E7_9FLAO) Endonuclease I {ECO:0000313|EMBL:EAQ41722.1} KW=Complete proteome; Reference proteome OX=313598 OS=Polaribacter sp. MED152. GN=MED152_03370 OC=Flavobacteriaceae; Polaribacter.
Sequence
MPYENNFMKKNDLLLILTFLFTISFYGQESYYNDVNLNVTGLTLKEELATKIISTHTQFL
FYDQIWDASKATDVNPENNQEVLLIYGFENGTDTDVTNDRAREIDNNSGASGDWNREHVY
SQSLGTPALSDSGPGSDAHHLRPADAQRNSSRNNRKFTDGSGNSGIQSNGGWYPGDEWKG
DVARMMMYMYVRYDDRCLMSNVGIGDNSATPDDMIDLFLKWNVEDPVSDFEKQRNTYHEN
TANQNAQGNRNPFIDNPILATRIWGGDNAEDTWGIYTSSDNEVPTAPTNLSASNITTFSV
DLTWEASTDNIGVTSYDVYVNNVLQIATSETSITITNLASNTNYSFAVLAKDITNNSSTL
SNVLNVTTLEDIEAPTVPTNLVISNETESSFIVSWSASTDNTNVALYEVYVDNVLNGNTA
DVTYTVTSLTANTTYKIEVLAIDNVGNKSALSSPINGSTTNGAGVATELFFSEYLEGESN
NKAIEIVNLTNTDIDLSSYSLARQSNGGLNGADWEWIMPLAGTIQSQDVYVVVNEAAGEH
TSSKTQAAIDAGDYLIQIADSIRIHDGDTNFGAPINFNGNDPVGLFKNGILIDIIGTYNG
GSANFGKDKVLRRKSGISQPNTAFDLDNEWEVFNKNDASDFGTHSAIVLSTNDFTNEHNI
HFYPNPTEDVLRIQNKSDSRISEISIYNTLGKEVLSVQNVSNEISLRVLPIGFYLLKYKI
ENQWFILKLIKK
Download sequence
Identical sequences A2U1E7
gi|472321187|ref|YP_007670710.1| WP_015480447.1.7039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]