SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2VDC0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2VDC0
Domain Number 1 Region: 29-138
Classification Level Classification E-value
Superfamily PH domain-like 1.76e-34
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0000564
Further Details:      
 
Domain Number 2 Region: 236-346
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 1.1e-22
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000335
Further Details:      
 
Domain Number 3 Region: 400-462
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000000000144
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A2VDC0
Sequence length 474
Comment (tr|A2VDC0|A2VDC0_XENLA) LOC100037214 protein {ECO:0000313|EMBL:AAI29740.1} OX=8355 OS=Xenopus laevis (African clawed frog). GN=LOC100037214 OC=Xenopus.
Sequence
MSRGGPKTGARLQDNVSSSLLLPQENQKVFQLLGRKCTTLATTVVQLLVAHGSDRWAKQF
VGVLCLVKDNPRRSYFFQLFDLRDEKMVWEQEIYEQLKYNTPRLYFHIFCSDDCQTGLNF
ADEGEAAAFQLVVEEKLKKKQHRQDRRQNLPPPPPVSDDRRTSLPLPPPPGPGPFPNGPT
SPQPLAPSQSLNMPAVSIPNPDITSARYRALSAPTDKDKNKKGKKKFSKADIGAPSGFKH
VSHVGWDPNSGFDVNQLDPDLRDLFSRAGISDAQLKDAETSKLIYDFIEQQGGVEAVKME
IRKAEPAPPPPPPSRNAPPAPSHSRGRTGPLPPPPVRGSSAPPPPPPSRSTPPLPPPTVR
SGGPPPPPPPPPPSAPVLPATSGPAPPPPPPLSGNQSTPTPSGGRGALLDQIRQGIQLNK
VTDSAEPPPSPQPSSEGLVDALIHVMQKRSKAIHSSDDDEEDGADDDDDDEWED
Download sequence
Identical sequences A2VDC0
gi|125858160|gb|AAI29740| gi|147901776|ref|NP_001091372| NP_001091372.1.7800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]