SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2VDT4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2VDT4
Domain Number 1 Region: 140-192
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.12e-16
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 2 Region: 117-148
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000165
Family Classic zinc finger, C2H2 0.029
Further Details:      
 
Weak hits

Sequence:  A2VDT4
Domain Number - Region: 211-240
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0194
Family Classic zinc finger, C2H2 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A2VDT4
Sequence length 267
Comment (sp|A2VDT4|OVOL1_BOVIN) Putative transcription factor Ovo-like 1 KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=OVOL1; OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MPRAFLVKKPCVSTCKRNWSELPDEERGEIYVPVSLGFCPPQPYQEPEPSVAEPPSCPLA
LDMSLRNSSYSVTPGPCVVAQLPSEDMSRLAGPQSRDHGFLRTKMKVTLGDGPSGDLFTC
HICQKAFTYQRMLNRHMKCHNDVKRHLCTYCGKGFNDTFDLKRHVRTHTGVRPYKCSLCD
KAFTQRCSLESHLKKIHGVQQKYAYKERRAKLYVCEECGCTSESQEGHVLHLKEHHPDSP
LLRKTSKKVAVALQNTVTSLLQGAHHV
Download sequence
Identical sequences A2VDT4
9913.ENSBTAP00000016791 NP_001074990.1.59421 NP_001074990.1.76553 XP_011972658.1.54773 XP_019810935.1.53367 XP_020762124.1.74333 ENSBTAP00000016791 ENSBTAP00000016791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]