SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2WQ27 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2WQ27
Domain Number 1 Region: 74-215
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.5e-33
Family Glutathione S-transferase (GST), C-terminal domain 0.0000103
Further Details:      
 
Domain Number 2 Region: 1-81
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.92e-24
Family Glutathione S-transferase (GST), N-terminal domain 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A2WQ27
Sequence length 218
Comment (tr|A2WQ27|A2WQ27_ORYSI) Uncharacterized protein {ECO:0000313|EMBL:EAY74073.1} KW=Complete proteome; Reference proteome OX=39946 OS=Oryza sativa subsp. indica (Rice). GN=OsI_01961 OC=Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
Sequence
MSPVKVFGRAISTNVSRVLVCLEEVGADYELVTVDFLAGEQNSPEHVERNPFGKIPALQD
GDLVLFESRAIAKYILRKYKSSEVDLLRESDIGEAALVDVWTEVEAHQYYPALSPIVFEC
IIFPIMRGVPTNQQVVDESLEKLKKVLETYEARLSASRYLAGDFLSFADLNHFPFTYYFM
ATPYASLFDAYPHVKAWWEGLMSRPSIKKISANMPTKF
Download sequence
Identical sequences A0A0E0G946 A2WQ27
ONIVA02G24990.2 OsIBCD001742 39946.BGIOSIBCE001875

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]