SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2WQ51 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2WQ51
Domain Number 1 Region: 73-211
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 9.55e-30
Family Glutathione S-transferase (GST), C-terminal domain 0.0000334
Further Details:      
 
Domain Number 2 Region: 1-79
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.96e-23
Family Glutathione S-transferase (GST), N-terminal domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A2WQ51
Sequence length 214
Comment (tr|A2WQ51|A2WQ51_ORYSI) Uncharacterized protein {ECO:0000313|EMBL:EAY74097.1} KW=Complete proteome; Reference proteome OX=39946 OS=Oryza sativa subsp. indica (Rice). GN=OsI_01983 OC=Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
Sequence
MAMKVYGLPMSTNVARVLVCLEEAGEQYEVVPIDFSTAEHKSPEHTSRNPFGQVPALQDG
DLILFESRAISKYVLRKNNSELLKEHNLSDAAKVDVWLEAESHHFDEPMSVVIYQCLILP
VYFGGQTDAKVVEENLEKLKKTFQVYEERLCKFRYLAGDFLSLADLSHFPTAYYLLATPH
AAMLDEFPLVKAWIDGMLARPSVKKVIEMMKATA
Download sequence
Identical sequences A0A0D9Y8N8 A0A0E0G935 A2WQ51 I1NN61
ONIVA02G24890.1 ORGLA01G0130100.1 39946.BGIOSIBCE001898 OGLUM01G18180.1 OsIBCD001765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]