SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2WQN6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2WQN6
Domain Number 1 Region: 154-653
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.02e-168
Family Calponin-homology domain, CH-domain 0.00000000000115
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A2WQN6
Sequence length 695
Comment (tr|A2WQN6|A2WQN6_ORYSI) Uncharacterized protein {ECO:0000313|EMBL:EAY74282.1} KW=Complete proteome; Reference proteome OX=39946 OS=Oryza sativa subsp. indica (Rice). GN=OsI_02171 OC=Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
Sequence
MGLDGLVVVSDPYLQRRFSQADLRALQAQYAALRDAAPSGRLRLRDLPAALSSAGVGAGK
GGDAEKENSAPAAAQLTEEEWASVLKAVARADERPHQGVGFELFLRVYAEMQLRLKGAAA
GKKAGGGGGGIARSSSSSAAAFLTAATTTLLHTISESEKASYVGHINAYLAEDPFLNTAL
PIDPATDHLFHLTKDGVLLCKLINLAVPGTIDERAINTKKLLNLWEKNENHTLCLNSAKA
IGCTVVNIGTQDLAEGRPHLILGLISQIIKIQLLADVNLKSTPQLVELVEDSKEMEELMS
LSPEKILLRWMNFQLKKGGFQRTVTNFSSDIKDSEAYACLLNVLAPECSAKPSPMSVKDL
LHRARLVLEHADRMGCKRYLTPKDIVDGLPNLNLAFVAHIFQKRNGLSKQMKQVSFVDGL
SDDAQVSREERSFRLWINSLGISTYINNVFEDLRNGWVLLEVIDKIAPGSVNWKMANRPP
IKLPFRKVENCNQVLKIGKELKFSLVNIAGNDIVQGNKKLILAFLWQLMRYNILQLLKNL
RFHSNGKEITDNDILIWANKKVKDSGKHSRMESFKDRSLSSGIFFLNLLGAVEPRVVNWS
LVTKGEKDEEKQMNASYIISVARKLGCSIFLLPEDILEVNQKMMLTLTASIMYWHLKKPT
SFSLDTENGSSCETSSISTSDDSASESSFDDSGAR
Download sequence
Identical sequences A0A0D3EPI9 A0A0D9Y9J9 A0A0E0FM86 A2WQN6 I1R2B6 Q5QMW7
OGLUM01G20580.1 LOC_Os01g33080.1|PACid:21905257 39946.BGIOSIBCE002080 39947.LOC_Os01g33080.1 LOC_Os01g33080.1|13101.m03340|protein OsIBCD001989 ORGLA01G0145000.1 ORGLA11G0190800.1 XP_015632792.1.37577 ONIVA01G19560.1 OBART01G17720.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]