SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2WYT9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2WYT9
Domain Number 1 Region: 2-103
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.49e-22
Family Thioltransferase 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A2WYT9
Sequence length 104
Comment (tr|A2WYT9|A2WYT9_ORYSI) Uncharacterized protein {ECO:0000313|EMBL:EAY77135.1} KW=Complete proteome; Reference proteome OX=39946 OS=Oryza sativa subsp. indica (Rice). GN=OsI_05100 OC=Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
Sequence
MAERVARLSSQRAVVIFGASNCFMCHVVKTLFSELGVSWAVHEVDKDPNGKDVERALAGM
VGRTPPVPAVFIGGKLVGPTDQVMSLHLAGKLVPLLREAGALWL
Download sequence
Identical sequences A0A0D3EYE5 A0A0D9YJR8 A0A0E0FYH3 A0A0E0N7C6 A2WYT9
ONIVA01G49150.1 OsIBCD037185 39946.BGIOSIBCE004895 OGLUM01G47520.1 OBART01G43220.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]