SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2X902 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2X902
Domain Number 1 Region: 128-629
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.77e-165
Family Calponin-homology domain, CH-domain 0.000000000000841
Further Details:      
 
Weak hits

Sequence:  A2X902
Domain Number - Region: 14-95
Classification Level Classification E-value
Superfamily EF-hand 0.000109
Family Calmodulin-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A2X902
Sequence length 706
Comment (tr|A2X902|A2X902_ORYSI) Uncharacterized protein {ECO:0000313|EMBL:EAY87312.1} KW=Complete proteome; Reference proteome OX=39946 OS=Oryza sativa subsp. indica (Rice). GN=OsI_08715 OC=Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
Sequence
MSGFVGVVVSDPSLQGQFTQVELRSLKAKFLSLKRDSGGHATTKNLPGLMKKLRGLNEVI
SEEEIAAHLSQSYPDADQEIEFESFLREYLNLQSRVSAKEGGGGGGGGGKTASSFLKSST
TTLLHNLNQAEKSSYVAHINTYLREDPFLKKYLPIEPTDNQLFDLVRDGVLLCKLINLAV
PGTIDERAINKKRVLNPWERNENHTLCLNSAKAIGCTVVNIGTQDLVEGRPHLILGLISQ
IIKIQLLADLNLKKTPQLVELFDDSKDIDEVLSLSPEKMLLRWMNHHLKKAGYKKTVSNF
STDVKDGEAYAYLLKALAPEHSPETTLETKDPSERAKLVLEQAEKLDCKRYLTPKDITEG
SANLNLAFVAQIFQHRNGLTSDTRQVTLNQTASRDDVLLSREERSFRMWINSLGVDSYVN
NVFEDVRHGWVLLEVLDKVSPGSVNWKLASKPPIKLPFRKLENCNQVVKIGKELKFSLVN
LAGNDIVQGNKKLIVALLWQLMRFNMLQLLNRLRSHSQGSQGKEITDADILKWANSKVKA
SGRTSQMESFKDKSLSNGRFFLELLSAVQPRVVNWKVVTKGEDDEEKKLNATYTISVARK
IGCSVFLLPEDIIEVNQKMILTLTASIMYWSLQKQPQSQSETSEQSEPSSMASDAASDIA
SEDAASITAASEGEEVNSLSDSMSNLTTYDAISNASPAENGNGVAG
Download sequence
Identical sequences A2X902
OsIBCD007779 39946.BGIOSIBCE008446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]