SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2XD09 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2XD09
Domain Number 1 Region: 144-247
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000103
Family Thioltransferase 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A2XD09
Sequence length 322
Comment (tr|A2XD09|A2XD09_ORYSI) Uncharacterized protein {ECO:0000313|EMBL:EAY88719.1} KW=Complete proteome; Reference proteome OX=39946 OS=Oryza sativa subsp. indica (Rice). GN=OsI_10194 OC=Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
Sequence
MGCTTSRQARHDLRHCPSPLALPRCQSFPARCAGDAGVHVVRLTSTTLGSLEVDKGAPRA
AEAPPMRRMVPRTPTMTPPNEPEAIDAWALMAGLEEHSPLLVPPFARHSFSFPITAVPPE
LAAASRKVTPLPLVEKKKASPVARPRKAVLYFTSLRGVRATHEDCCLARAILGGYGVRVD
ERDVSMHRGFRDELHGLLGLGRGAALAKCWAPAAAPALPSLFVDGELVGNADELKRLHEA
GELAARLAGCESAAPGEAAGACEACADVRFVLCGACSGSCKVYVDDGDDDDENPLDGGGG
GGFRRCTECNENGIVRCPVCCC
Download sequence
Identical sequences A0A0E0GHG1 A0A0E0NQB9 A2XD09 Q8S7X1
XP_015630259.1.37577 LOC_Os03g07470.1|PACid:21914960 LOC_Os03g07470.1|13103.m00835|protein OsIBCD038523 39946.BGIOSIBCE009834 39947.LOC_Os03g07470.1 ONIVA03G05130.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]