SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2XLM8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2XLM8
Domain Number 1 Region: 83-180
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000992
Family Glutathione peroxidase-like 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A2XLM8
Sequence length 258
Comment (tr|A2XLM8|A2XLM8_ORYSI) Uncharacterized protein {ECO:0000313|EMBL:EAY91738.1} KW=Complete proteome; Reference proteome OX=39946 OS=Oryza sativa subsp. indica (Rice). GN=OsI_13379 OC=Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
Sequence
MAAAAASTSLPVPRVSLPPSARPAAAPRHGLLIPGRRGCFRLRGSPAAPAAAASGSPSVP
SSSPEAGSGIGDALGGVAIYSAATGEPVLFRDLWDQNEGMAVVALLRHFGCPCCWELASV
LRDTKERFDSAGVKLIAVGVGTPDKARILAERLPFPLDYLYADPERKAYDLLGLYFGIGR
TFFNPASASVFSRFDSLKEAVKNYTIEATPDDRASVLQQGGMFVFRGKELIYARKDEGTG
DHAPLDDVLNICCKAPAA
Download sequence
Identical sequences A2XLM8 I1PF32 Q851F6
ORGLA03G0297800.1 OsIBCD011865 XP_015628233.1.37577 LOC_Os03g51950.1|PACid:21915209 39946.BGIOSIBCE012842 39947.LOC_Os03g51950.1 LOC_Os03g51950.1|13103.m05658|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]