SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2XMN2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2XMN2
Domain Number 1 Region: 97-228
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.51e-40
Family Glutathione S-transferase (GST), C-terminal domain 0.000000125
Further Details:      
 
Domain Number 2 Region: 6-85
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.42e-22
Family Glutathione S-transferase (GST), N-terminal domain 0.0000123
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A2XMN2
Sequence length 231
Comment (sp|A2XMN2|GSTU1_ORYSI) Probable glutathione S-transferase GSTU1 KW=Complete proteome; Reference proteome OX=39946 OS=Oryza sativa subsp. indica (Rice). GN=GSTU1; OC=Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
Sequence
MAEEKELVLLDFWVSPFGQRCRIAMAEKGLEFEYREEDLGNKSDLLLRSNPVHRKIPVLL
HAGRPVSESLVILQYLDDAFPGTPHLLSPANSGDADAAYARATARFWADYVDRKLYDCGS
RLWRLKGEPQAAAGREMAEILRTLEAELGDREFFGGGGGGRLGFVDVALVPFTAWFYSYE
RCGGFSVEEVAPRLAAWARRCGRIDSVAKHLPSPEKVYDFVGVLKKKYGVE
Download sequence
Identical sequences A2XMN2
39946.BGIOSIBCE013198 OsIBCD039499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]