SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2YLQ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2YLQ3
Domain Number 1 Region: 83-245
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 2.27e-36
Family PAPS reductase-like 0.0034
Further Details:      
 
Domain Number 2 Region: 317-430
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.63e-23
Family PDI-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A2YLQ3
Sequence length 432
Comment (tr|A2YLQ3|A2YLQ3_ORYSI) Uncharacterized protein {ECO:0000313|EMBL:EAZ04014.1} KW=Complete proteome; Reference proteome OX=39946 OS=Oryza sativa subsp. indica (Rice). GN=OsI_26153 OC=Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
Sequence
MASATASISSHSVALRDLKAARIGAVKQQVAAAPAAGTAAARAQRARAEYYKSKTGHVGF
VGDGKGNAKPVISARFNEPGHSGAEDVALIEYAKLTGRPFRVFSLDTGRLNPETYQLFDK
VEKHYGIRIEYMFPDAGEVQALVRAKGLFSFYEDGHQECCRARKVRPLRRALRGLRAWIT
GQRKDQSPGTRAAIPVVQVDPSFEGLAGGAGSLVKWNPVANVDGKDVWTFLRAMDVPVNA
LHAQGYVSIGCEPCTRPVLPGQHEREGRWWWEDAKAKECGLHKGNIDDQGGAAAAAAHKA
GGANGNGSAGAPDIFESSGVVSLTRAGVENLLRLESRAEPWLVVLYAPWCPFCQAMEASY
LELAERLGGAGGGVKVGKFRADGEQKAFAQQELQLQSFPTILLFPSRTARPIKYPSEKRD
VDSLLAFVNSLR
Download sequence
Identical sequences A2YLQ3
OsIBCD023586 39946.BGIOSIBCE024917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]