SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2Z0Z3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2Z0Z3
Domain Number 1 Region: 11-253
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 2.92e-35
Family Haloperoxidase 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A2Z0Z3
Sequence length 259
Comment (tr|A2Z0Z3|A2Z0Z3_ORYSI) Uncharacterized protein {ECO:0000313|EMBL:EAZ09004.1} KW=Complete proteome; Reference proteome OX=39946 OS=Oryza sativa subsp. indica (Rice). GN=OsI_31266 OC=Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
Sequence
MVDLADNQLVCCSGRYNHFAKLLNDHGLKVYAMDWIGHGGSDGVHGYVSSLDHAVGDLKE
FLEDVVLEENYGLPCFLFGHSTGGAIVLKAVLDPCVEVHVEGVILTSPAIHVQPSHPIIK
VVAPIFSVLAPKYRVAALHRRGPPVSRDPEALKIKYADPLVYTGPIRVRTGNEILRISSY
LQRNLSRVTVPFLVLHGTADTITDPGASQRLYQSSASAHKSIKLYDGYLHDLLFEPERDD
IANDIINWLSSRLDVLQRW
Download sequence
Identical sequences A2Z0Z3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]