SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2Z410 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2Z410
Domain Number 1 Region: 4-114
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.27e-19
Family Thioltransferase 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A2Z410
Sequence length 125
Comment (tr|A2Z410|A2Z410_ORYSI) Uncharacterized protein {ECO:0000313|EMBL:EAZ10071.1} KW=Complete proteome; Reference proteome OX=39946 OS=Oryza sativa subsp. indica (Rice). GN=OsI_32377 OC=Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
Sequence
MARPGAVKNIESWDEFTKHFVKSEYKLVVLVFMAPWSEPWKLMRPAVEKMASGLKSEEAE
VCTISVDRFNTLGRLLRVEALPTFVLVKRHRAVARVVGVNRDDLHSSINKHLAPPSSSPQ
PINIS
Download sequence
Identical sequences A2Z410
39946.BGIOSIBCE030896 OsIBCD029379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]