SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2Z9L3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2Z9L3
Domain Number 1 Region: 90-226
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 4.73e-34
Family Glutathione S-transferase (GST), C-terminal domain 0.00000462
Further Details:      
 
Domain Number 2 Region: 10-112
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.94e-24
Family Glutathione S-transferase (GST), N-terminal domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A2Z9L3
Sequence length 238
Comment (tr|A2Z9L3|A2Z9L3_ORYSI) Uncharacterized protein {ECO:0000313|EMBL:EAY79297.1} KW=Complete proteome; Reference proteome OX=39946 OS=Oryza sativa subsp. indica (Rice). GN=OsI_34423 OC=Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
Sequence
MAGGGGAGELKLLGHWASSYVTRVKLALHLKGVSYEYVEEDLRNKSDLLLASNPVHKTVP
VLIHNGNPIRESQIIVQYIDEAFSGAGDSLLPADPHERAVARFWAAYIEDKLVAPWEKVF
RAKTEEERAAWMKQMFVAVEALEGGLKECSKGKGCFFGGDSVGYVDVVLGGGVSFVHAND
VITGGKLFDAAKTPLLAEWLGRFGELDAAKAVLQDVDRAVEYTKVLYARNAATNAANN
Download sequence
Identical sequences A2Z9L3
OsIBCD031285 39946.BGIOSIBCE032850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]