SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2Z9L7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2Z9L7
Domain Number 1 Region: 80-220
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 8.87e-36
Family Glutathione S-transferase (GST), C-terminal domain 0.0000193
Further Details:      
 
Domain Number 2 Region: 8-111
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.75e-25
Family Glutathione S-transferase (GST), N-terminal domain 0.0000803
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A2Z9L7
Sequence length 230
Comment (tr|A2Z9L7|A2Z9L7_ORYSI) Uncharacterized protein {ECO:0000313|EMBL:EAY79301.1} KW=Complete proteome; Reference proteome OX=39946 OS=Oryza sativa subsp. indica (Rice). GN=OsI_34427 OC=Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
Sequence
MAGRNNHELKLLGTWPSPFVVRVRLALGLKGLSYEYVEQDIRDKSELLVVSNPVHKKVPV
LIHGGKPVCESQIIVQYIDEAFPGAGASLLPSDPHERAVARFWATYIDDEFATKFRAMGE
AKEEEEKDEAAAQVFAALETLEEAMKGKVFFGGDSAGYVDVALGGFLGWIKAAEALAGVA
FLDGARTPLLAAWAARFSALEAAKEAIPSVERLREFHVAMHAAAATVAGN
Download sequence
Identical sequences A0A0E0BCY9 A0A0E0HIC9 A2Z9L7
OGLUM10G16480.1 39946.BGIOSIBCE032854 OsIBCD031289 ONIVA05G27520.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]