SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A3DBG6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A3DBG6
Domain Number 1 Region: 78-351
Classification Level Classification E-value
Superfamily (Trans)glycosidases 6.57e-22
Family YicI catalytic domain-like 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A3DBG6
Sequence length 729
Comment (tr|A3DBG6|A3DBG6_CLOTH) Uncharacterized protein {ECO:0000313|EMBL:ABN51295.1} KW=Complete proteome; Reference proteome OX=203119 OS=thermocellum). GN=Cthe_0054 OC=Ruminiclostridium.
Sequence
MERRCKRLVCILLSFLVIAGVFTFSGAKTEPWSAYQKFIPNETPVVKRHLRGVWISTVAN
LDWPSVETRKIENPSERIRKTKEELVEIFDKAVEMNLNAVFLQVSPEGDAFYKSDIVPWS
RYLTGTFGEDPGFDPLEFAIEEAHKRNLELHAWFNPYRVSTNTSAATISSLKVEKSVYKE
HPDWIRTAMNRFVVDPGIPEARQWVIDRVMEVVKKYDVDGVHFDDYFYYEQYVGELKDQD
TYNKYNKGQFSNIGDFRRNNTYLLVKELSQKIRATKPWVKFGISPSGVWGNKSDGHSYGS
NTSASLTNYDKSFADTKKWVQEELIDYIAPQVYFTFANSRAPYGEIALWWSDVCRGKNVH
LYIGQAFYKINDDSDQYFKGENAVPELTRQLKFNAVKPEIMGTVLFRFANFKDSGKQQAV
NAVKNDLWSQKALIPPMPWKGGNAPDAPILGRLESLPDGVEISWMDNDPDTAYFAIYRFN
AGEKMDITSDSSAYKLIATVRKNSNGVQKFVDYGVLDADSVYYVVTALDRLHNESEGLAI
STNQSEYFPDVGMKYSWAVDAIDMLYEKGVVKGDESGMFNPGVNTKRADFTIMIVKALAL
KADFEDNFADVRKDAYYYEAVGVARALGIVKGDGKNFNPDANITREDMMVIVVNALKAAG
AKIDEADEQFLENYGDANSISGYARKSVAVLTKAGVVNGYDGKIHPKSLATRAEIAVVVS
KLLTNIEYL
Download sequence
Identical sequences A3DBG6
Cth-3111 WP_003518396.1.19387 WP_003518396.1.20586 WP_003518396.1.31213 WP_003518396.1.55520 WP_003518396.1.6636 WP_003518396.1.6965 gi|125972578|ref|YP_001036488.1| gi|385779504|ref|YP_005688669.1| 203119.Cthe_0054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]