SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A3DC18 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A3DC18
Domain Number 1 Region: 199-466
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.66e-71
Family Regulator of chromosome condensation RCC1 0.03
Further Details:      
 
Domain Number 2 Region: 109-238
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 6.8e-29
Family Regulator of chromosome condensation RCC1 0.062
Further Details:      
 
Domain Number 3 Region: 35-103
Classification Level Classification E-value
Superfamily Type I dockerin domain 1.37e-18
Family Type I dockerin domain 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A3DC18
Sequence length 469
Comment (tr|A3DC18|A3DC18_CLOTH) Dockerin type 1 {ECO:0000313|EMBL:ABN51497.1} KW=Complete proteome; Reference proteome OX=203119 OS=thermocellum). GN=Cthe_0258 OC=Ruminiclostridium.
Sequence
MRKYGLKKIVWMLGILCFLVVSLNTSIFAADGKNVVLGDVNGDSKINAIDVLLMKKYILK
VINDLPSDGVKAADVNADGQINSIDFTWLKKYMLKAVEKFPGEASNNPDAVIQFESGFAH
SVLLKKDGTVWVLGNNGKGQLGLPEVSAVNEPVMINGLSGIKSVAAGREHTLALQEDGTL
WAWGNNYSLQLIEYMERDPDTKERFTSIPIKVETHSDIKYVAAKFSRTLIVKNDGTVWLY
SLPPINTSSDAEYMPWEIKGFGDIKMADIGTGHIVALREDGTVWTWGENVWGQLGNGWQQ
HHNIHTYIYFEPNQAKNLSDIVSIAAGDAHSVALKSDGTVWTWGSNFNGELGNGTTTYIL
EPKKVEGLEDIVAIDAGIGHTVALKADGTVWVWGKNSYGQLGNGTTMRSTVPIQVEGLEG
IVAIQAGMECTIAYKNDGTVWAWGKNDFGQLGDGTFENILRPVKVFERK
Download sequence
Identical sequences A3DC18
gi|125972780|ref|YP_001036690.1| gi|385779304|ref|YP_005688469.1| WP_003512395.1.19387 WP_003512395.1.20586 WP_003512395.1.31213 WP_003512395.1.55520 WP_003512395.1.60145 WP_003512395.1.6636 WP_003512395.1.6965 203119.Cthe_0258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]