SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A3DC88 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A3DC88
Domain Number 1 Region: 51-150
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000383
Family Regulator of G-protein signaling, RGS 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A3DC88
Sequence length 278
Comment (tr|A3DC88|A3DC88_CLOTH) Uncharacterized protein {ECO:0000313|EMBL:ABN51567.1} KW=Complete proteome; Reference proteome OX=203119 OS=thermocellum). GN=Cthe_0329 OC=Ruminiclostridium.
Sequence
MLEIISCSRRTDIPAFYYDWLQECLKNKYAVVKNPYNKSTYMVDLSCEKVHSICLWSKSF
ANVLKDPKYLSLYNLYFQFTITGYSKFLEPNVIDTNEAVRQMEQLAQKYSPRQINWRFDP
IIFSAEGEKEPTPDNFERARLKVFENLCKDISSFGVNRCTISFLCLYKKVEQRMKKCNFT
YFPPSQQKQIEFVSRLVEIADKYQVTIYTCSSPVIESVPGVKKGHCIDGAYLEELFGKRA
SRAKDSGQRKECGCTRSKDIGGYDNQSCRHGCVYCYAR
Download sequence
Identical sequences A3DC88
WP_003512569.1.16390 WP_003512569.1.19387 WP_003512569.1.20586 WP_003512569.1.31213 WP_003512569.1.55520 WP_003512569.1.60145 WP_003512569.1.6636 WP_003512569.1.6965 203119.Cthe_0329 gi|385779231|ref|YP_005688396.1| gi|125972850|ref|YP_001036760.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]