SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A3DCH1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A3DCH1
Domain Number 1 Region: 307-813
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 1.02e-155
Family Cellulases catalytic domain 0.00000000000000289
Further Details:      
 
Domain Number 2 Region: 42-198
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.78e-39
Family CBM4/9 0.0028
Further Details:      
 
Domain Number 3 Region: 210-304
Classification Level Classification E-value
Superfamily E set domains 5.04e-27
Family E-set domains of sugar-utilizing enzymes 0.0000114
Further Details:      
 
Domain Number 4 Region: 829-894
Classification Level Classification E-value
Superfamily Type I dockerin domain 7.19e-20
Family Type I dockerin domain 0.0000423
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A3DCH1
Sequence length 895
Comment (sp|A3DCH1|CELK_CLOTH) Cellulose 1,4-beta-cellobiosidase KW=Complete proteome; Reference proteome OX=203119 OS=thermocellum). GN=celK; OC=Ruminiclostridium.
Sequence
MNFRRMLCAAIVLTIVLSIMLPSTVFALEDKSPKLPDYKNDLLYERTFDEGLCFPWHTCE
DSGGKCDFAVVDVPGEPGNKAFRLTVIDKGQNKWSVQMRHRGITLEQGHTYTVRFTIWSD
KSCRVYAKIGQMGEPYTEYWNNNWNPFNLTPGQKLTVEQNFTMNYPTDDTCEFTFHLGGE
LAAGTPYYVYLDDVSLYDPRFVKPVEYVLPQPDVRVNQVGYLPFAKKYATVVSSSTSPLK
WQLLNSANQVVLEGNTIPKGLDKDSQDYVHWIDFSNFKTEGKGYYFKLPTVNSDTNYSHP
FDISADIYSKMKFDALAFFYHKRSGIPIEMPYAGGEQWTRPAGHIGVAPNKGDTNVPTWP
QDDEYAGRPQKYYTKDVTGGWYDAGDHGKYVVNGGIAVWTLMNMYERAKIRGIANQGAYK
DGGMNIPERNNGYPDILDEARWEIEFFKKMQVTEKEDPSIAGMVHHKIHDFRWTALGMLP
HEDPQPRYLRPVSTAATLNFAATLAQSARLWKDYDPTFAADCLEKAEIAWQAALKHPDIY
AEYTPGSGGPGGGPYNDDYVGDEFYWAACELYVTTGKDEYKNYLMNSPHYLEMPAKMGEN
GGANGEDNGLWGCFTWGTTQGLGTITLALVENGLPSADIQKARNNIAKAADKWLENIEEQ
GYRLPIKQAEDERGGYPWGSNSFILNQMIVMGYAYDFTGNSKYLDGMQDGMSYLLGRNGL
DQSYVTGYGERPLQNPHDRFWTPQTSKKFPAPPPGIIAGGPNSRFEDPTITAAVKKDTPP
QKCYIDHTDSWSTNEITINWNAPFAWVTAYLDEIDLITPPGGVDPEEPEVIYGDCNGDGK
VNSTDAVALKRYILRSGISINTDNADVNADGRVNSTDLAILKRYILKEIDVLPHK
Download sequence
Identical sequences A3DCH1
203119.Cthe_0412 WP_011837826.1.31213 gi|125972933|ref|YP_001036843.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]