SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A3DCJ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A3DCJ2
Domain Number 1 Region: 39-78,105-518
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 1.87e-126
Family Cellulases catalytic domain 0.0000000402
Further Details:      
 
Domain Number 2 Region: 546-700
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 9.94e-29
Family Cellulose-binding domain family III 0.0006
Further Details:      
 
Domain Number 3 Region: 721-788
Classification Level Classification E-value
Superfamily Type I dockerin domain 5.3e-19
Family Type I dockerin domain 0.00034
Further Details:      
 
Weak hits

Sequence:  A3DCJ2
Domain Number - Region: 87-112
Classification Level Classification E-value
Superfamily EF-hand 0.0427
Family Calmodulin-like 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A3DCJ2
Sequence length 789
Comment (tr|A3DCJ2|A3DCJ2_CLOTH) Glycoside hydrolase family 9 {ECO:0000313|EMBL:ABN51671.1} KW=Complete proteome; Reference proteome OX=203119 OS=thermocellum). GN=Cthe_0433 OC=Ruminiclostridium.
Sequence
MREKKIFSKRTKALIVSFVILALMVFPVGTVNISAANVEYNYAKALQYSIYFYDANMCGT
GVDENGQYNWRGDCHVYDAELPLDSVNTNMSDAFIRENISVLDPDGDGKVDVSGGFHDAG
DHVKFGMPEAYSGSTLGWGYYEFREQYKQTGQDQHIETILRYFNDYFMRCTFRDKDGNVV
AFCYQVGDGDIDHAYWNPPEIDDMFRRGWFATKHLPSTDCVSAAAASLAVNYFNFKDTDP
EYAEKSLDYAKALFDFAQKNDKEVNADGPKGYYTSSKWQDDYCWAAAWLYLATQDDNYLN
ELFKYYDYYAPSCWTHCWNDVWAGTACILAQIDDLYDKDSEEFENRYRQAANKSPYEPID
FWAEVAKLVENWMYGKTVTITPGGYAFLNKWGSARYNTATQFVALVYDKHHGDAPSAYSQ
WARSQMEYLMGNNPLNRCYIVGYSDISVKFPHHRAASGLSKCEDPDPHKYVLYGALVGGP
DENDQHIDMTSDWVYNEVTIDYNAAFVGACAGLYRYFGDPSMEITPNFPPKVEISDPDNG
GSYWVEAFGVDIVQSDGPKATEVTLYVRSDSRKPSKNISVRYFFDATGMSSVDPDKMEIR
QLYDQTAAETDYAAKLTGPHHYKDNIYYVEISWEGFAIANSNKKYQFALGTYTWGNSWDP
TDDWSYQELKIEESNYTGTPARNNRICVYDAGVLVGGIEPDGTTPQSPTPSPTPTPPQEP
EFTYGDLNGDGRVNSSDLALMKRYVVKQIEKLNVPVKAADLNGDDKVNSTDYSVLKRYLL
RSIEVIPIK
Download sequence
Identical sequences A3DCJ2
gi|385779130|ref|YP_005688295.1| 203119.Cthe_0433 WP_003519072.1.16390 WP_003519072.1.19387 WP_003519072.1.20586 WP_003519072.1.31213 WP_003519072.1.55520 WP_003519072.1.60145 WP_003519072.1.6636 WP_003519072.1.6965 gi|125972954|ref|YP_001036864.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]