SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A3DDT8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A3DDT8
Domain Number - Region: 82-110
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000575
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.051
Further Details:      
 
Domain Number - Region: 4-32
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.0033
Family Rubredoxin 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A3DDT8
Sequence length 139
Comment (tr|A3DDT8|A3DDT8_CLOTH) Regulatory protein, MerR {ECO:0000313|EMBL:ABN52117.1} KW=Complete proteome; Reference proteome OX=203119 OS=thermocellum). GN=Cthe_0883 OC=Ruminiclostridium.
Sequence
MIDVVTCEICGRLYNNPSGFFRVCPTCYENDENEFQKIKDYLNVHPCAKIFDVVADLNIS
IKQIKRYLRESRLEILEKDNHFLLCESCGKSIRTGRYCDECYKNRHKNIRAVYSGSSNIK
HSNAIRFRTDGNSKRASSI
Download sequence
Identical sequences A3DDT8
gi|125973400|ref|YP_001037310.1| 203119.Cthe_0883 gi|385778686|ref|YP_005687851.1| WP_003517217.1.16390 WP_003517217.1.19387 WP_003517217.1.20586 WP_003517217.1.31213 WP_003517217.1.55520 WP_003517217.1.60145 WP_003517217.1.6636 WP_003517217.1.6965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]