SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A3DES4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A3DES4
Domain Number 1 Region: 2395-2920
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 1.93e-105
Family Glycosyltransferase family 36 C-terminal domain 0.000000836
Further Details:      
 
Domain Number 2 Region: 2129-2390
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 2.51e-85
Family Glycosyltransferase family 36 N-terminal domain 0.000048
Further Details:      
 
Domain Number 3 Region: 1631-1901
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 9.42e-79
Family Glycosyltransferase family 36 N-terminal domain 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A3DES4
Sequence length 2922
Comment (tr|A3DES4|A3DES4_CLOTH) Glycosyltransferase 36 {ECO:0000313|EMBL:ABN52453.1} KW=Complete proteome; Reference proteome OX=203119 OS=thermocellum). GN=Cthe_1221 OC=Ruminiclostridium.
Sequence
MQMQLYILYLLGLFGILLCLFLLAIFSNCNERQRQLKVQDASLTFDELEAYAKEIAIEHS
VSGKKSMFSWPIPRMNDNYRYIMSVYKEMNEDVQKGISTTPAAEWLLDNFYIIEEQVKSL
RRDLTKEVYAKLPVLDSGHLKGYARIYSIALELLSHTDGRIDEKVLVNYIKAYQSNNVLT
GRELWAFPIMLKLVLIEKTRYICEKIAKAQEQRRKVEEILKAFDENIENTTQLITAIDNE
LKGKYEVNSAFIEYLAYKFRKMGRAYTHVLRYIDERLGESGTTVDDITQKEHNEQTASKA
SIGNCIMSLKFISTVNWVDIFEQLSKVEQILREDPSGFYSLMDFDSRNYYRNRVEKLALK
YKVSESHVAKKAVELARNAVENGNLTDKRLTHVGYYLVGKGICELEKEIGYEKSFNQRMF
ERIKEHPACLYFGFIGFITVLLLLCVTKYSLFRAEKYGIALSIIAVLATIIPATDIAVNF
VNWVLCKMIKPSLLPKLDFENGIPEEYATMVVIPALLPDENRARELIDNLEVYYLANREK
NLYFSIAGDFKDAPNKEMAGDKKIIETALGRIAELNEKYGRKNEGGEKDSRDIFYYFHRH
RQFNEKQNKWMGWERKRGALLEFNEVLLGSRTTSYSIMSHDVSQLPKIKYVITLDADTIL
PLGAARKLIGTMAHPLHRPVIDEQKGIVTEGYGLLQPRIGFDIESVNKSLFSRIFAGEEG
IDPYASAISDVYQDLFGEGIFTGKGIYDLEVFQKLLKDAIPDNTVLSHDLLEGSYVRAGL
VTDIEFIDGYPSKLNSYAMRLHRWVRGDWQLLPWLRGKTKDRKGNVIKNPLSLISRWKIL
DNLRRSIVAPSITLLIALGFSILPGSSLFWLGASLLTIYFPLITGTIDYIASKPLGAITS
KRYKPAICGLKASFLQMTLQFVFLPYNAWLMVHAAVLSLVRVLFTKRNMLEWVTALDAER
GLKNSLKGYVIKMKAAAFQALVVVVLAFAFKTGFSAAVSVLPFAVWVSSPFIAYWISKET
VYKTETLSDEENLELRRIARKTWRYYEEFVNRRNNYLAPDNFQEDPPNGIAYRTSPTNIG
LGMLAALTARDLGYIGTLELCDIISRTMSTVEKMEKWNGHLYNWYDTRTLETLRPRYIST
VDSGNFVCYLITLKEGLAEYLNRPLEDRAFIDGIRDTASLIADENENPYKDISCLKECIV
ISEGRSYVDIPQMMKALTKLSEDGNKMKDSKDVWKAKVDSMIEMLKIELYTYMPWCDMID
ELTEAFEKSEADIKEAFHGIIRKLNSDYSLKAMPVVYRETIKQIEKLRKKLKDGQQKNIE
GLDRLKEALEGATESADKLVKRYVDLINRICRIADETEFVHLYDKKKQLFSIGYNIEENS
LTNSYYDLLASEARQTSYIAIARGEVDQQHWFKLGRTLTQIDRYKGMVSWSGTMFEYFMP
LLIMKSHKNTLLDETYSFVVRSQKKYGKQRNLPWGISESGFYSFDINLDYQYKAFGVPWL
GLKRGLVEDMVVSPYATMLVLPLVPRDAMDNLKRLIAEGAYGHYGMYEAIDYTPERIPLG
EKKGIVKSYMAHHQGMSILALNNYFNDNIMQKRFHADPVVDAAKLLLMEKVPSNIVFTKE
NKEKILPFKDVVYDEKDFLRECGMPDPVLPKAHILSNGNYSVMVTDRGTGYSRWKNLDVT
RWREDVTLDNYGMFFYIRDVQNDEVWTSTFAPGRKKPDEYKVEFTSGKAKYYRKDGDIDT
LTEIVVCAGENAEIRSITLANHGQESCVMEITSYFEPVLSHHGADIAHPAFGNLFIRTEF
LAEHNCLIAGRRPRSEKEKPVWIMNTVVLEGEGVGSLQYETDRMQFIGRGRNVSEPVALE
PHRPLTNSVGAVLDPVMSFRQIVRVEPGKSVKISFVTAVANSREDVVEMATKFKSPQVIK
DELGMAVTKSRVEARYLNLDTEEIELYQDMISHILFISPLQRQKQKWVMNNKKGQPGLWP
YGISGDIPIVLVMLDKTDDIDIVREVLKAHEYWRLKKLAVDLVILNEEENSYTNPVNSLL
MDIIAESHAHDLINKPGGVFILKKSNMPPEDIDLICSVSRIILKGDAGDLKDQVKYARSI
ALAEFKQFEKKPASYDSKLAKDLELNFYNGLGGFGKDGKEYVIFLENGQNTPLPWINVIS
NQRFGFIVTESGSGYTWFENSRENKLTPWSNDPVSDTPGEILYVMDEHAGDVWSVTPLPV
REKEPYMIRHGFGYTVFSHASHGIEQEMVQFVPVDDSVKISILKLKNQSQENRGLSLTYY
IRPVLGVSDQFTAMHINTKADNGMIVIKNNYNDEFPGRVAFIDSSLKVNSLTCDRKEFFG
AGDIANPEGIKRTSLSGTTGAGFDPCAAISVSVNLKPDEEKEIIFLLGAGRDEEEARQLS
AKYKKLEEAKKALGEVKKFWELKLGALQFETPNTAMDILLNGWLLYQVVSCRLWTRSGFY
QSGGAYGFRDQLQDSISLTHIWPEATRNQILLHSRHQFIEGDVQHWWHEEKYKGTRTKFS
DDLLWMPYATIEYIRITGDYDILYEETPFLEDEPLKEFEDEAYRVPRISHTVSTLYDHCI
RAINRSLKFGEHGIPLIGSGDWNDGMNTVGNKGKGESVWLGWFLYSILKNFAPLCERMGD
NELAKRYLDTADRIVENIEKNAWDGKWYRRAYFDNGVPLGSIQNSECQIDSLAQSWAVIS
EGGDKERIAEAMSALENYLVKRDEGLIKLLTPPFDEGDLEPGYIKSYVPGVRENGGQYTH
AAAWVVMAFAKMGDGEKAMELFDLLNPINHSRTHIEYSRYKVEPYVMAADVYSVPPHTGR
GGWTWYTGSAGWIYRVGFEYILGFKKRGETLEIDPCIPGKWTDFTIKYRYYDTDYIIEVK
NPEGVNTGVKKVIVDGKVCDDGKVQLVNDKDTHKVEVYMGKK
Download sequence
Identical sequences A3DES4
gi|125973736|ref|YP_001037646.1| 203119.Cthe_1221 WP_011838029.1.31213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]