SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A3DFA2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A3DFA2
Domain Number 1 Region: 13-337
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.74e-87
Family beta-glycanases 0.0000062
Further Details:      
 
Domain Number 2 Region: 346-414
Classification Level Classification E-value
Superfamily Type I dockerin domain 7.55e-20
Family Type I dockerin domain 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A3DFA2
Sequence length 415
Comment (tr|A3DFA2|A3DFA2_CLOTH) Arabinogalactan endo-beta-1,4-galactanase {ECO:0000256|RuleBase:RU361192} KW=Complete proteome; Reference proteome OX=203119 OS=thermocellum). GN=Cthe_1400 OC=Ruminiclostridium.
Sequence
MLSKITKLTVIFILILSVTFLSMPKTYTQAAPTFAKGADVSWLPEMEANGYKFYNDDGIE
QDCLQILKDHGIDSIRLRVWVNPPNGYCNKEETIKMALRAKKMGFRIMINFHYSDSWADP
GKQTKPAAWAKYDFNGLMKAVYDYTYDVMSALKANGITPEWVQVGNETNNGMLWEDGKAT
NSMRNFAWLINCGYDAVKAVSPETKVIVHIANGYDNALYRWIFDGITANGARFDVIGMSL
YPTASDWPQLTNQCLNNMKDMISRYGKEIMICEIGMDYWEAQACKDFITDIIQKTKSLPD
NKGLGVFYWEPQCYNWQYYNKGAFDLSGKPTIALDAFLTSDTPDNLIYGDLNGDGRVNST
DYTLLKRYLLGAIQTFPYERGIKAADLNLDGRINSTDYTVLKRYLLNAIPSLPVK
Download sequence
Identical sequences A3DFA2
WP_003518272.1.16390 WP_003518272.1.19387 WP_003518272.1.20586 WP_003518272.1.31213 WP_003518272.1.55520 WP_003518272.1.60145 WP_003518272.1.6636 WP_003518272.1.6965 203119.Cthe_1400 gi|125973914|ref|YP_001037824.1| gi|385778204|ref|YP_005687369.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]