SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A3DHG9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A3DHG9
Domain Number 1 Region: 26-331
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 6.52e-72
Family alpha-L-arabinanase-like 0.0028
Further Details:      
 
Domain Number 2 Region: 322-453
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.04e-42
Family Family 6 carbohydrate binding module, CBM6 0.00018
Further Details:      
 
Domain Number 3 Region: 467-532
Classification Level Classification E-value
Superfamily Type I dockerin domain 1.47e-17
Family Type I dockerin domain 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A3DHG9
Sequence length 533
Comment (tr|A3DHG9|A3DHG9_CLOTH) Glycoside hydrolase family 43 {ECO:0000313|EMBL:ABN53398.1} KW=Complete proteome; Reference proteome OX=203119 OS=thermocellum). GN=Cthe_2196 OC=Ruminiclostridium.
Sequence
MRKVLLSLLISTLIITFYIPSCFADNPIVQTIYTADPAPMVYNGVCYVYTTHDEDVLIDN
FFTMNDWRCYSTTDMANWTDHGTVLSYTDFSWSSGKAWAGQCVERNGKFYFYVPLAKKGG
GEAIGVAVSDSPTGPFKDALGKPLIDRGGWGEIDPTVFIDDDGQAYLYWGNPDLYYVKLN
PDMISYSGGIVKVPLTTAGFGQRSKNDRPTSYEEGPWFYKRNNLYYMVFAAGPIPEHIAY
STSTSPTGPWTYRGVIMPTQGGSFTNHPGIIDYKGNSYFFYHNAALPGGSGYHRSVCVEQ
FQYNPDGTIPRINMTKEGPPQIGTLNPYVRTEAETICWSSGIETEKCSEGGMNVGFIENG
DYIKVKGVNFGTGAASFEARVASATNGGNIEIRLDSPTGKLVGTCTVTGTGGWQTWTTKS
CPVSGAEGVHDLYFVFKGGSGYLFNIDWWKFTPANPDPTPTPMPDKRLGDLNNDGKVNST
DFQLLKMHVLRQELPAGTDLSNADVNRDGKVDSSDCTLLKRYILRVISDFPQN
Download sequence
Identical sequences A3DHG9
gi|125974681|ref|YP_001038591.1| WP_003513660.1.19387 WP_003513660.1.20586 WP_003513660.1.31213 WP_003513660.1.55520 WP_003513660.1.60145 WP_003513660.1.6636 WP_003513660.1.6965 gi|385780126|ref|YP_005689291.1| 203119.Cthe_2196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]