SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A3DJ76 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A3DJ76
Domain Number 1 Region: 58-123
Classification Level Classification E-value
Superfamily E set domains 0.0000000616
Family E-set domains of sugar-utilizing enzymes 0.029
Further Details:      
 
Domain Number 2 Region: 135-207
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000145
Family beta-mannanase CBM 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A3DJ76
Sequence length 234
Comment (tr|A3DJ76|A3DJ76_CLOTH) Uncharacterized protein {ECO:0000313|EMBL:ABN54005.1} KW=Complete proteome; Reference proteome OX=203119 OS=thermocellum). GN=Cthe_2806 OC=Ruminiclostridium.
Sequence
MKKNKILAVVASCLLLISVFANTATPAFGEATGAPGKPILGIVEDNGVISCKIILLADNN
NGTRWRLYENGKLIQCGSAEDNTPEPQVIILEPFTRPAGQYKYKCELINKYGSTFSDERI
FTVNHGFIDEVPQAIFTEDFENGANGWTVVSSDPGSTVVIENGTGIYGSKCVKISSSVFS
DTAYTKQISGLTIGEKYRLTAYVKYQDVVRDPNSFYWPVIGPNVCIYPTWDLFR
Download sequence
Identical sequences A3DJ76
203119.Cthe_2806 gi|125975288|ref|YP_001039198.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]