SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A3DJ79 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A3DJ79
Domain Number 1 Region: 416-672
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-78
Family Glycosyl hydrolases family 16 0.002
Further Details:      
 
Domain Number 2 Region: 688-849
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.98e-37
Family CBM4/9 0.0016
Further Details:      
 
Domain Number 3 Region: 1021-1173
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.36e-36
Family CBM4/9 0.0017
Further Details:      
 
Domain Number 4 Region: 870-1014
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.69e-34
Family CBM4/9 0.0044
Further Details:      
 
Domain Number 5 Region: 1177-1320
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 8.67e-32
Family CBM4/9 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A3DJ79
Sequence length 1321
Comment (tr|A3DJ79|A3DJ79_CLOTH) Glucan endo-1,3-beta-D-glucosidase {ECO:0000313|EMBL:ABN54008.1} KW=Complete proteome; Reference proteome OX=203119 OS=thermocellum). GN=Cthe_2809 OC=Ruminiclostridium.
Sequence
MYKRLLSSVLIIMLLLSAWSPISVQASDGINDIRGHWAEEDLNKWMEKGILVGYQDGTIR
PDNNITRAEFVTLINKVFGLYELSREQFADVEDSKWYSREILKARAAGYIAGYGSNVFKP
DNYITRQEAVVIIAKVFELQSGSNYTSKFKDGSLVKEYAKDSVSALVEKGYIAGYEDGTF
RPDNYITRAETIKILNKIIPSLYNEKGDYKNEEVAGNALINTEGVILKDTVINGDLYLAQ
GIQNGDVTLDGVNVKGTVFVNGGGSDSIHFINTKINRVVVNKTGVRIVTSGNTSVESVVV
KSGAKLEEKELTGDGFKNVTVDSQLSAGNEIIFVGDFEQVDVLADDALLETKEAKMKLRI
FGQRIKVNGKAIEKSSKNYIVNGELISTEEEPGPSDAPGAEDDQNSGSPGSSTNPAPTKN
PNEEWRLVWSDEFNGSEINMANWSYDDPTNGRWNGEVQSYTQNNAYIKDGALVIEARKED
ITEPSGETYHYTSSKLITKGKKSWKYGKFEIRAKMPQGQGIWPAIWMMPEDEPFYGTWPK
CGEIDIMELLGHEPDKIYGTIHFGEPHKESQGTYTLPEGQTFADDFHVYSIEWEPGEIRW
YIDGKLYHVANDWYSRDPYLADDYTYPAPFDQNFFLILNISVGGGWPGYPDETTVFPQQM
VVDYVRVYQKDKYPHREKPAKEEVKPREPLEDGNYIYNGGFDVDDSAAVGVDGVPYTSYW
TFLTASGGAATVNVEEGVMHVQIENGGTTDYGVQLLQAPIHLEKGAKYKASFDMKAENPR
QVKLKIGGDGDRGWKDYAAIPPFTVSTEMTNYEFEFTMKDDTDVKARFEFNMGLDDNDVW
IDNVKLIKTEDAPVIDPSEIARPPLLSGNYIYNGTFDQGPNRMGFWNFVVDSTAKATYYI
GSDVNERRFETRIEKGGTSRGAIRLVQPGINIENGKTYKVSFEASAANTRTIEVEIASNL
HNSSIFATTFEISKESKIYEFEFTMDKDSDKNGELRFNLGGSNVNVYIDNVVMKRVSTDE
VEGNLILNGVFNGLAGWGYGAYEPGSADFESHEEQFRAIISSVGNEGWNVQLYQDNVPLE
QGQTYEVSFDAKSTIDRKIIVQLQRNGTSDNNWDSYFYQEVELTNELKTFKYEFTMSKPT
DSASRFNFALGNTENKTYAPHEIIIDNVVVRKVATPSALILNGTFDDGMDHWLLYWGDGE
GNCDVTDGELEINITKVGTADYMPQIKQENIALQEGVTYTLSLKARALEARSIKVDILDS
SYNWYGGTIFDLTTEDAVYTFTFTQSKSINNGVLTINLGTIEGKTSAATTVYLDDILLEQ
Q
Download sequence
Identical sequences A3DJ79
gi|125975291|ref|YP_001039201.1| 203119.Cthe_2809 WP_020457929.1.31213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]