SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A3DJ81 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A3DJ81
Domain Number 1 Region: 178-501
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.24e-68
Family beta-glycanases 0.00012
Further Details:      
 
Domain Number 2 Region: 520-590
Classification Level Classification E-value
Superfamily Type I dockerin domain 4.12e-21
Family Type I dockerin domain 0.00029
Further Details:      
 
Domain Number 3 Region: 62-164
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000128
Family Family 6 carbohydrate binding module, CBM6 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A3DJ81
Sequence length 591
Comment (tr|A3DJ81|A3DJ81_CLOTH) Dockerin type 1 {ECO:0000313|EMBL:ABN54010.1} KW=Complete proteome; Reference proteome OX=203119 OS=thermocellum). GN=Cthe_2811 OC=Ruminiclostridium.
Sequence
MENKTSIKVFLALMLAVLMPVVSCINVSNAVLSDGDKYEFEDGIHKGAQIYTDYVGQNEY
GEVFDLTGSTCSFIAQKGTSTSVNVEVDKEGLYEIFICYVQPYDKNKKVQYLNVNGVNQG
EISFPFTLKWREISAGIVKLNAGINNIELESYWGYTYFDYLIVKPADESIVELKVPKKLV
NPNATKEAKALMSYLVDIYGKHILSGQQEICGSHNYPGSEAEFTYIQEKTGKLPAIRGFD
FMNYRGNGLMWDDQCAERVIEWYKEKGGIPTVCWHWFSPGDIGKKADNSFYTESTTFSIS
RALTPGTEENIALLNDIDTMARKLKQVQDAGVPVLFRPLHEAEGGWFWWGAEGPEPCVRL
YRLLYDKFTNEYGLNNLIWVWTSYDYETSAAWYPGDDVVDIIGYDKYNAKDGKPNGSAIS
STFYNLVKLTNGKKLVAMTENDTIPRVSNLVNEKAGWLYFCPWYGWWLTSEQNNPVDWLV
EMYQSDYCITLDELPDLKNYPISDYEDSNPDPSPTPTQPPKITYGDLNGDGKVNSTDLTI
MKRYILKNFDKLAVPEEAADLNGDGRINSTDLSILHRYLLRIITSFPVEQQ
Download sequence
Identical sequences A3DJ81
WP_003514483.1.16390 WP_003514483.1.19387 WP_003514483.1.20586 WP_003514483.1.31213 WP_003514483.1.55520 WP_003514483.1.60145 WP_003514483.1.6636 WP_003514483.1.6965 Cth-2304 gi|125975293|ref|YP_001039203.1| 203119.Cthe_2811 gi|385777775|ref|YP_005686940.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]