SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A3DJL8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A3DJL8
Domain Number 1 Region: 30-330
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.51e-81
Family Pectin methylesterase 0.00000371
Further Details:      
 
Domain Number 2 Region: 500-567
Classification Level Classification E-value
Superfamily Type I dockerin domain 8.04e-18
Family Type I dockerin domain 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A3DJL8
Sequence length 567
Comment (tr|A3DJL8|A3DJL8_CLOTH) Pectinesterase {ECO:0000256|RuleBase:RU000589} KW=Complete proteome; Reference proteome OX=203119 OS=thermocellum). GN=Cthe_2949 OC=Ruminiclostridium.
Sequence
MIKNKKILLLLCINLCLFFLLINRIQLVSSAAVNADIIVAKDGTGNFTTIQAAIDSVPSN
SSKRTVIFVKNGTYKEVVTIRKNNIHLIGESNTKTIITYDNYAGKLKPDGTTYGTSGSAS
FYLYGTDTILENITIENSFDESIDVKDKQAVAAYIRGDRQIIKNCIFIGNQDTLYAHSGR
QYYVNCKIIGDTDFIFGGATAVFENCEIVSTPKGGYVTAASTDLENYGFLFLNCRLTSDA
PKNSTYLGRPWRPNAYVVYKTCYLGAHIKESGWTSMSGNLPENARFFEYKNTGPGAVVNS
SRRQLSYAEAAKFTPQNLLKGTDNWNPVALVSQTSTLTPTQKPTSTPAPTPMDGQLIKSL
TVKDSANSSNWSIQSNLRVGDTVFGDRTYKFVTIPNEFLGSEWIRTACDSKKSTEDLAYF
TAKADITVYVGLDSRVATIPSWLNDWTKTSLTITDDGSPQVTYNLYKKNFSANSVVTLGP
NGASSGAVNYIVIVKQNNQNIVYGDLNGDGLVNSSDYSLLKRYILKQIDLTEEKLKAADL
NRNGSVDSVDYSILKRFLLKTITQLPV
Download sequence
Identical sequences A3DJL8
WP_020457967.1.31213 203119.Cthe_2949 gi|125975430|ref|YP_001039340.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]