SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A3DKA4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A3DKA4
Domain Number 1 Region: 402-486
Classification Level Classification E-value
Superfamily Copper amine oxidase, domain N 1.18e-30
Family Copper amine oxidase, domain N 0.0042
Further Details:      
 
Domain Number 2 Region: 129-249
Classification Level Classification E-value
Superfamily Collagen-binding domain 3.79e-20
Family Collagen-binding domain 0.0019
Further Details:      
 
Domain Number 3 Region: 22-125
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000000000000981
Family Collagen-binding domain 0.0042
Further Details:      
 
Domain Number 4 Region: 255-373
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.000000000000183
Family Collagen-binding domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A3DKA4
Sequence length 495
Comment (tr|A3DKA4|A3DKA4_CLOTH) Copper amine oxidase-like domain-containing protein {ECO:0000313|EMBL:ABN54383.1} KW=Complete proteome; Reference proteome OX=203119 OS=thermocellum). GN=Cthe_3188 OC=Ruminiclostridium.
Sequence
MVLAVNFGTVTTFAAMSDEAESISVNKPVTDNLSSVNDVKYYEVELPAPGKVNLSFSHAN
LERTYVYWKVTMFDSVENEVLYFESTGTNTDGKSMSVYLDKGTYYVRVKSEGYWYSTTDY
TLCVNYTENKGEYEIEPNYSKELATEISVNKPVIGNHRVKGDTDFYKFTISEPGKVDLSF
NHANLERTYVYWKVTMFDSVENIVLYFESTGTNTTGKSMNAYLSEGTYYIRVTTDDYWHS
TADYTLCVNYTENQGEYEIEPNNSQDNATLIEVDEPVTGNLRTSSDVDYYRFVMPDSGKV
YLGFNHPNLERTYVYWKVSLYDANGNRLYQLNSRGTDTVGKSDEIKIGSGTYYVKVEYEG
YWHSSADYSLTVNTVGGIPKVKVFLNGKRIRFDQPPIIQNGRTLVPLRAIFEAMNATVSW
DDKTKTVTAKKGDTTIVMTIGNKTMKKNGVAIELDVPPQIVNGRTLVPARAVAESFGAKV
DWDGSTRTVTITEGN
Download sequence
Identical sequences A3DKA4
203119.Cthe_3188 gi|385778101|ref|YP_005687266.1| gi|125975666|ref|YP_001039576.1| WP_003516105.1.16390 WP_003516105.1.19387 WP_003516105.1.31213 WP_003516105.1.60145 WP_003516105.1.6636 WP_003516105.1.6965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]