SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A3DLS1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A3DLS1
Domain Number - Region: 17-110
Classification Level Classification E-value
Superfamily Prefoldin 0.000654
Family Prefoldin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A3DLS1
Sequence length 140
Comment (tr|A3DLS1|A3DLS1_STAMF) Uncharacterized protein {ECO:0000313|EMBL:ABN69581.1} KW=Complete proteome; Reference proteome OX=399550 OS=F1). GN=Smar_0472 OC=Desulfurococcaceae; Staphylothermus.
Sequence
MSAVVKEFSSFADLIKNIDEELNTLKQQLADYLRRLEDIRAKSEQERRLRELLKNLTGEE
QTSKGKVVDLKDVKLYVNPDAEQEATVMEEIIDRINKTIQSLQSIRKALEPLSNVEVEAK
IVVVYKEGVPSSIILKLSSM
Download sequence
Identical sequences A3DLS1
WP_011838772.1.69113 gi|126465380|ref|YP_001040489.1| 399550.Smar_0472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]