SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A3DNE9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A3DNE9
Domain Number 1 Region: 176-524
Classification Level Classification E-value
Superfamily HydB/Nqo4-like 1.14e-111
Family Nqo4-like 0.0000329
Further Details:      
 
Domain Number 2 Region: 9-181
Classification Level Classification E-value
Superfamily Nqo5-like 2.22e-35
Family Nqo5-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A3DNE9
Sequence length 548
Comment (tr|A3DNE9|A3DNE9_STAMF) NADH dehydrogenase (Ubiquinone), 30 kDa subunit {ECO:0000313|EMBL:ABN70159.1} KW=Complete proteome; Reference proteome OX=399550 OS=F1). GN=Smar_1061 OC=Desulfurococcaceae; Staphylothermus.
Sequence
MINRIDSVRQHIIEKLGDIVKETKYIGDQALMLRIDRNYLRKAVDIIHNDLNAYFRTMVA
VDERSLNGTFASYYIFGLDAAHLNIIVKTHTSADEPVLPSIIDIVPAADWYELEAWDLLG
IKFENRKVHRFVLPDEWPEGIYPLRKDVEYTYRPKPRKVPRQPPTGQRIPIGPYHPALHE
PEYFELYVEGEKVVDVEYNGFHVHRGIEKLAEAPRFNYQKIPFLAERICGICGFVHSVSY
TMSVERAAKIDVPERAEYIRSIILEIERLHSHLLWIGVVCHLLGYDAGFMHTWRIREKVM
VLAELLTGSRKTYGINLVGGVRKDINMDKIEAVKNTIEYIRSEFKHLSDLITSISQIVKR
ASGTGILSRDDARKLSVVGPVARGSGLDRDVRRDYPYAAYRDVYFKVPVYNEGDNLARLL
VRIDEVFESIYILEQLIDKLPGGPIMAEKLEVPEGVIGIGNVEAPRGEVIHVTITGHGRP
YRWRVRAPTYQNIPALKIMLRDAPLADAPLTIASIDPCFSCTDRIVIVDLRSNRRFKASM
EQIIKAGR
Download sequence
Identical sequences A3DNE9
WP_011839350.1.69113 399550.Smar_1061 gi|126465958|ref|YP_001041067.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]