SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A3KNG1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A3KNG1
Domain Number 1 Region: 63-155
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000000706
Family F-box domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A3KNG1
Sequence length 487
Comment (tr|A3KNG1|A3KNG1_DANRE) Zgc:161973 protein {ECO:0000313|EMBL:AAI33821.1} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=zgc:161973 OC=Cyprinidae; Danio.
Sequence
MAKLTGLSEFLRTIRQGLDQTEQTARAEAQNGDCVRKRKSHVSNPLQTETSKTVFEESPN
NWQENYLERLPSEIILKILSSLDASSLFNISFVNKRFHDLANSNALWSVLYASEIEKKKW
RPRVSVAEGMRSTHAEGKPSGYWKKMLLKEMAGYKDTMWKTELKHKNPHTGMPALTEEVL
RRLHIQWEITLTFRNGRESVYKQTHTFFEDSSVTVFWSNGCWPLMHNLDSLKLHGIMCRP
VGAPGDKPRWRSLICKTATDKSVHWVFLGYDRLVKLLQFGKIIIGVWRGNWRIAFIMINL
HFHKLIEKSLLGSRFCPYIPTEDNAVDPDCVRHGYTLHIVLHNPVRRIMCQRFSPLYTSR
VGLQGEYVQLNAVDFSDSSEHMPVVRICLPWQAEGLKGNVERCCMMTLTVLDEAQRPFWC
VSSPVRMSSNPRVVDVEYEGEQFIILYEDAEGKVKMTFVWMEEFQHFFLVQLFTVFSVAK
VKKHFWG
Download sequence
Identical sequences A3KNG1
NP_001076275.1.45394 ENSDARP00000043955 ENSDARP00000043955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]