SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A3MU44 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A3MU44
Domain Number 1 Region: 23-101
Classification Level Classification E-value
Superfamily SMAD/FHA domain 1.34e-18
Family FHA domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A3MU44
Sequence length 103
Comment (tr|A3MU44|A3MU44_PYRCJ) FHA domain containing protein {ECO:0000313|EMBL:ABO08161.1} KW=Complete proteome OX=410359 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1). GN=Pcal_0735 OC=Thermoproteaceae; Pyrobaculum.
Sequence
MEVFEVEVFPPAVVLRSRDGRFAVEVDGYRVFGRSDFAWHPLAGYISRRHFAVKRVDGSY
YVVDLGSTNGTFVNGVDIRGRGLYPLKRGDVINVAGVVELVVE
Download sequence
Identical sequences A3MU44
410359.Pcal_0735 gi|126459349|ref|YP_001055627.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]