SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A3MUP2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A3MUP2
Domain Number 1 Region: 57-150
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.09e-17
Family Cold shock DNA-binding domain-like 0.0016
Further Details:      
 
Domain Number 2 Region: 146-226
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.01e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.00048
Further Details:      
 
Domain Number 3 Region: 1-56
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 0.0000000000916
Family ECR1 N-terminal domain-like 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A3MUP2
Sequence length 235
Comment (tr|A3MUP2|A3MUP2_PYRCJ) Exosome complex component Rrp4 {ECO:0000256|HAMAP-Rule:MF_00623} KW=Complete proteome OX=410359 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1). GN=Pcal_0934 OC=Thermoproteaceae; Pyrobaculum.
Sequence
MYYVTPRQLIFPGDLVATADSRVEGPVYVDNGKIRSAVVGLVEFREDVVVIVPLDGVYKP
KKGDLVIGYVTDVLATGWEVDVRTFMPAYLPVSEALHKHVDLETTPLTTFLNIGDVIVAK
VKDVDLTDEYPVVLTLKEERVGKVESGTVVEIAPVKVPRVVGKKGSMLAVLAEVGCDIVV
GQNGRIWVKCKSPRDEVFLTSLIKKIEAESHVMGLTDRVKAEVENYKKMRQQAQA
Download sequence
Identical sequences A3MUP2
410359.Pcal_0934 gi|126459547|ref|YP_001055825.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]