SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A3N5M8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A3N5M8
Domain Number 1 Region: 2-234
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 2.05e-41
Family Dienelactone hydrolase 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A3N5M8
Sequence length 243
Comment (tr|A3N5M8|A3N5M8_BURP6) Carboxymethylenebutenolidase {ECO:0000313|EMBL:ABN85253.1} KW=Complete proteome OX=320373 OS=Burkholderia pseudomallei (strain 668). GN=BURPS668_0597 OC=Burkholderiaceae; Burkholderia; pseudomallei group.
Sequence
METRSIAYDCGGARLAGYFADDAPNTKKPAVLIAHEAFGLNEHIRARARRLAELGYAAFA
LDMYGAEGFPMPEAMRRHIELMSTPGLMHARASAALSVLMEQPGVDRERVAAIGFCQGGI
SALELARGGAPIRCAVGFHPGLMRPAGSQDGPIRAKVLMMIGARDPDVPAADQAAFAAEM
QEKQVDWQLHLFGGVGHAYTNPDADGWNKPGYGYSRAADQRAWTMMLALFDEVFGGAAAV
GKA
Download sequence
Identical sequences A3N5M8
gi|126442254|ref|YP_001057649.1| 320373.BURPS668_0597 WP_011851058.1.45356 WP_011851058.1.52882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]