SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A3QH89 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A3QH89
Domain Number 1 Region: 1-131
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.57e-43
Family SMI1/KNR4-like 0.00000329
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A3QH89
Sequence length 133
Comment (tr|A3QH89|A3QH89_SHELP) Uncharacterized protein {ECO:0000313|EMBL:ABO24837.1} KW=Complete proteome; Reference proteome OX=323850 OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4). GN=Shew_2971 OC=Shewanellaceae; Shewanella.
Sequence
MHDLIEQLRELSETVPVPLELPSFDQLVEVEEQILIPLPAELKEYLLYASDVIHGTLEPV
TAADPYAHTYLPEVTSYAWSIGMPREYIAICQQGDDFYCIDQEGQVMLWQDGELAEESWE
SFWQWVEEVWIPA
Download sequence
Identical sequences A3QH89
323850.Shew_2971 WP_011866768.1.33760 gi|127513899|ref|YP_001095096.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]