SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A3R6S5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A3R6S5
Domain Number 1 Region: 55-272,315-421,460-514
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.88e-83
Family Duffy binding domain 0.00034
Further Details:      
 
Domain Number 2 Region: 507-579
Classification Level Classification E-value
Superfamily Duffy binding domain-like 0.00000000392
Family Duffy binding domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A3R6S5
Sequence length 594
Comment (tr|A3R6S5|A3R6S5_PLAFA) Erythrocyte membrane protein 1 {ECO:0000313|EMBL:ABM88755.1} OX=5833 OS=Plasmodium falciparum (malaria parasite P. falciparum). GN=IT4_var23 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MAPGSGGGNDYSDAKDFLDKIGQKVHEEIVKNAEAKTFKGELEGKLSLAKASGGEMGDTN
DPCRFNYTKVIKATDNNETCGKGKEDRFSKERVDEYDNKKMKCSNGDACAPFRRLHLCNK
NMVKMDTNNDDSSKAKHNLLVDVCMAAKYEGESLNTYSAQYDSKYPGSGFTLCTMLARSF
ADIGDIIRGKDLFRGNKKKNQTERDKLEENLQKIFKQIHDDVTSTRGSNGQALKTRYKDD
REKNYFQLREDWWTANRETVWEAMTCSKELDNSSYFRATCNDTGQGPSQTHNKCRCDKDK
GANAGKPKAGDGDVTIVPTYFDYVPQYLRWFEEWAEDFCRKKKKYVDIVKTYCRDETKGK
YCSLNGYDCTKTKLAIGKYRMGNQCTKCFLACYPYVHWIDKKKEEFDKQKNKYEKEMQKY
ENGASSSSGSGSGRQRRGVRSNNNYEGYEKIFYEKLEESGYKDVGKFLDLLSEEKTCKDI
TDDKEGIIDFNEHVDKDKEYKGTFYHSEYCQPCPYCGMKKKDPGKGWEKKSETDKCNSGN
LYKPTSGAIHTPINFLYSGDKRQDIEKKLEAFCKTQNGTGGVANGSGSGTSGSK
Download sequence
Identical sequences A3R6S5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]