SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A3R6U5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A3R6U5
Domain Number 1 Region: 50-272,315-422,461-515
Classification Level Classification E-value
Superfamily Duffy binding domain-like 5.23e-86
Family Duffy binding domain 0.00013
Further Details:      
 
Domain Number 2 Region: 508-725
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.83e-32
Family Duffy binding domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A3R6U5
Sequence length 725
Comment (tr|A3R6U5|A3R6U5_PLAFA) Erythrocyte membrane protein 1 {ECO:0000313|EMBL:ABM88775.1} OX=5833 OS=Plasmodium falciparum (malaria parasite P. falciparum). GN=IT4_var58 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MATSGGSGGTQDEDAKHVLDEFGQKVHDEVHGEAKNYVSELKGSLSLASILGETAFTENP
CKLESKYTELIEANSKRNPCKKDGKGNDVDRFSVKEQAEYDNKKMKCSNGDACAPFRRLH
LCNKNFPNMNSNDSSKAKHDLLAEVCMAAKYEGESIKTHYPKYDSKYPGSDFPMCTMLAR
SFADIGDIIRGRDLYLGNKKKKQNGKETEREKLEQKLKEIFKKIHDNLKDKEAQKRYNGD
EDPNFYKLREDWWTANRETVWEAMTCSKELDNSSYFRATCNDTGQGPSQTHNKCRCDKDK
GANAGKPKAGDGDVTIVPTYFDYVPQYLRWFEEWAEDFCRKKKKKLENAKNKCRGPSGTD
KYCSLNGCDCTKTVRARGKLRYGNRCIDCLYACNPYVHWIDKKKEEFDKQKNKYEKEMQK
YENGASSSSGSGSGRQRRGVRSNNNYEGYEKIFYEKLEESGYKDVGKFLDLLSEEKTCKD
ITDDKEGIIDFNEHVDKDKEYKGTFYHSEYCQPCPYCGMKKKDPGKGWEKKSETDKCNSG
NLYKPTSGAIHTPINFLYSGDKRQDIEKKLEAFCKTQNGTGGVANGSGSGTSGSKELYQY
WKCYEGKDVEIDVKDEDHDEEDYQNVINAGGLCILKKEEQSEKKIESEGNSQNNHADIQK
TFNDFFNFWVAHMLKDSIHWRTKKIKGCLENGTKKCGKNCKDNCGCFEKWVKQKKDEWTN
IKKHF
Download sequence
Identical sequences A3R6U5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]