SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A3R726 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A3R726
Domain Number 1 Region: 43-248
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 6.02e-109
Family Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 0.0000000108
Further Details:      
 
Domain Number 2 Region: 1-42
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 4.32e-17
Family Methyl-coenzyme M reductase alpha and beta chain N-terminal domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A3R726
Sequence length 248
Comment (tr|A3R726|A3R726_9ARCH) Methyl coenzyme M reductase alpha subunit {ECO:0000313|EMBL:ABN69025.1} OX=115547 OS=uncultured archaeon. GN=mcrA OC=Archaea; environmental samples.
Sequence
AMQIGMSMISAYKQAAGEAATGDFAYAAKHAEVIHMGTYLPVRRARGENEPGGIAFGFLD
DIVQTPRKYPDDPVRQTLDVVAAGAALYDQIWLGSYMSGGVGFTQYATAAYTDNVLDDFT
YFGKEYVEDKYEMTEAPNMDTVLDVGSEVTFYALEQFEDYPALLETVFGGSQRASLVAAA
AGCSTAFATGNAQTGLSAWYLSMYLHKEQHSRLGFYGYDLQDQCGASNVFSIRGDEGLPT
ELRGANYP
Download sequence
Identical sequences A3R726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]