SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A3UAL1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A3UAL1
Domain Number 1 Region: 50-286
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 2.41e-24
Family Haloperoxidase 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A3UAL1
Sequence length 288
Comment (tr|A3UAL1|A3UAL1_CROAH) Uncharacterized protein {ECO:0000313|EMBL:EAP86847.1} KW=Complete proteome; Reference proteome OX=216432 OS=Croceibacter atlanticus (strain ATCC BAA-628 / HTCC2559 / KCTC 12090). GN=CA2559_12443 OC=Flavobacteriaceae; Croceibacter.
Sequence
MTTTKKDAVPVQALLMPKQFIAIGKIIQFFSPKLASRFAAKLFLTPFKYPMPEREKHMYN
NSRIERLTVPSINREIVVFHYGTSPKKVLLCHGWSGSGTQLAKIAESLEKKGYSTISFDA
PAHGRAPGKISMMPFFIESVKYLHEKYPFQLAIGHSLGGMSLLKAVSDGLPLDRLSIIGT
ANSITHITKDFVRNMRLKPEVATHLKSYMDGKFGEDLDNYSGAVSAKNVNIPTLVVHDKD
DVDVHYSSAQEINSVLDKGSLLLTEKLGHRRILGHPETIEEITSFITE
Download sequence
Identical sequences A3UAL1
gi|298209051|ref|YP_003717230.1| WP_013188228.1.96744

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]