SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A3YVP4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A3YVP4
Domain Number 1 Region: 8-219
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.00000000000926
Family Haloperoxidase 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A3YVP4
Sequence length 232
Comment (tr|A3YVP4|A3YVP4_9SYNE) Uncharacterized protein {ECO:0000313|EMBL:EAQ76196.1} KW=Complete proteome; Reference proteome OX=69042 OS=Synechococcus sp. WH 5701. GN=WH5701_15356 OC=Synechococcus.
Sequence
MNRRPLELIAMHGWAGDSRAWRPWQQAATRRGWSWQSGERGYGQLPPHTPHWPEQGGPRA
VIVHSLGLHLLPAEVLAAAQAVVLLASFGRFVPAGPRGRRWRQALGGMGRRLEAGDSAAM
LNDFLREAAAPAPVELLPAGPSSGVMPAEGMERLRQDLLLLEQCSAVPPAFPTGARSLIV
EAGDDHIVAPESRAALGEALPAAERWPLAGAGHSLLGTDLVEPVLNWLEAGC
Download sequence
Identical sequences A3YVP4
WP_006172000.1.93065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]