SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A4FUH7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A4FUH7
Domain Number 1 Region: 3-89
Classification Level Classification E-value
Superfamily EF-hand 1.02e-17
Family S100 proteins 0.0000677
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A4FUH7
Sequence length 99
Comment (tr|A4FUH7|A4FUH7_BOVIN) S100A3 protein {ECO:0000313|EMBL:AAI14900.1} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=S100A3 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MASLLEQALATLVRTFQEYSQFSGNPLCQAKFKELLEKELPTWAPTTLRECDYKQFISVL
DTNKDCQVDFVEYMRLLACLCIYCHEYFKDSPLKPSCAQ
Download sequence
Identical sequences A4FUH7 L8HS94
9913.ENSBTAP00000044222 NP_001076999.1.59421 NP_001076999.1.76553 XP_005910070.1.15283 XP_010836720.1.44457 XP_010836721.1.44457 XP_010836722.1.44457 XP_019813906.1.53367 ENSBTAP00000044222 ENSBTAP00000044222

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]