SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A4FV38 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A4FV38
Domain Number 1 Region: 148-215,356-389
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000127
Family Calmodulin-like 0.031
Further Details:      
 
Domain Number 2 Region: 236-275,307-390
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000157
Family Calmodulin-like 0.045
Further Details:      
 
Weak hits

Sequence:  A4FV38
Domain Number - Region: 10-88
Classification Level Classification E-value
Superfamily ClpP/crotonase 0.0464
Family Crotonase-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A4FV38
Sequence length 430
Comment (tr|A4FV38|A4FV38_BOVIN) Mitochondrial calcium uptake 2 {ECO:0000313|Ensembl:ENSBTAP00000044088} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=EFHA1 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MAAAGGSRLAAWGERLRRGFAAGRRAWPGPGPVAAAVAGVAVAGAGAAWYHGRVNVAAPQ
GSLTVLAQRSVNPGEITGKLSPRKQRFMQFSSLEYGGEYYMTPRDFLFSVMFDHIQRKSS
VKRLTDKDIEDTLAGIKKAGCGSTFFRDLGDKGLISYTEYLFLLTILTKPHSGFHVAFKM
LDADGDEMVEKKEFFKLQKIISKQDDLKTAITDETECQEQTVQEPEINTTLQIRFFGKRG
ERKLHYKEFRRFMENLQAEVQEMEFLQFSKGLSFMRKEDFAEWLLFFTDTENKDVYWKNV
REKLSAGENISLEEFKSFCHFATHLEDFAIAMQMFSLAHRPVRLAEFKRAVKVATGQELS
NNILDTVFKIFDLDGDECLSHEEFLGVLKNRMHRGLWVPQHLGIQEYWKCVKKESIKGVK
EVWKQAGKDL
Download sequence
Identical sequences A4FV38
NP_001076885.1.59421 NP_001076885.1.76553 ENSBTAP00000044088 ENSBTAP00000044088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]